PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00001547.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family EIL
Protein Properties Length: 618aa    MW: 69885.7 Da    PI: 5.2529
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00001547.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3515.62.2e-157484281353
                                     XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                            EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipe 79 
                                     +el++rmw+d+m+lkrlke++ +    k++ + ++k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipe
  FANhyb_rscf00001547.1.g00001.1  48 DELERRMWRDKMRLKRLKEQTTKGG--KDV-IVTAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPE 123
                                     79********************955..888.677789****************************************** PP

                                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS- CS
                            EIN3  80 kgkpvegasdsLraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdpp 158
                                     kgkpv+gasd+Lr+WWk+kv+fdrngpaaiskyqa+n++++++++++     ++h+l+elqDTtlgSLLsalmqhcdpp
  FANhyb_rscf00001547.1.g00001.1 124 KGKPVTGASDNLREWWKDKVRFDRNGPAAISKYQADNAVPGRNDGCNP-IGPTPHTLQELQDTTLGSLLSALMQHCDPP 201
                                     **********************************************88.9***************************** PP

                                     TTS--TTT--HHHH---S--HHHHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT CS
                            EIN3 159 qrrfplekgvepPWWPtGkelwwgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdk 237
                                     qrrfplekgv+pPWWP+G+e+ww+elgl+kdqg+ppykkphdlkkawkv+vLtavikhmsp+i++ir+l+rqsk+lqdk
  FANhyb_rscf00001547.1.g00001.1 202 QRRFPLEKGVPPPWWPSGNEEWWPELGLPKDQGPPPYKKPHDLKKAWKVGVLTAVIKHMSPDIAKIRKLVRQSKCLQDK 280
                                     ******************************************************************************* PP

                                     --SHHHHHHHHHHTTTTT-S--XXXXXX...XXXXXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXX........... CS
                            EIN3 238 msakesfallsvlnqeekecatvsahss...slrkqspkvtlsceqkedvegkkeskikhvqavktta........... 302
                                     m+akes ++l+++nqee ++++++++s    s+   s ++++++ +++dveg +++   +vq++k  +           
  FANhyb_rscf00001547.1.g00001.1 281 MTAKESSTWLAIINQEECLARELYPNSCpplSSAGASGSLVVNDCSEYDVEGAEDEPNFDVQECKPDNlhslnfgmetm 359
                                     **************************4444666779***************777777699******99*********** PP

                                     ....................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
                            EIN3 303 ....................gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                                                         ++++ rkrk ++s+ ++v +++ ++tc+  q+++se  ++f+d++s+++++
  FANhyb_rscf00001547.1.g00001.1 360 rerlqvhqptsfpvkgdaitNLEFMRKRK-PSSDLNMVVDQK-IYTCEFVQCPYSEFCHGFHDRTSRDNHQ 428
                                     ****************************9.677777777776.5*************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048735.6E-13148297No hitNo description
Gene3DG3DSA:1.10.3180.108.6E-76171307IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167684.32E-62176300IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009873Biological Processethylene-activated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 618 aa     Download sequence    Send to blast
MMMMFDEMGF CGDLDFISAT PGGEVAIPQA ETEATMEDDY TDDEIDVDEL ERRMWRDKMR  60
LKRLKEQTTK GGKDVIVTAK QRQSQEQARR KKMSRAQDGI LKYMLKMMEV CKAQGFVYGI  120
IPEKGKPVTG ASDNLREWWK DKVRFDRNGP AAISKYQADN AVPGRNDGCN PIGPTPHTLQ  180
ELQDTTLGSL LSALMQHCDP PQRRFPLEKG VPPPWWPSGN EEWWPELGLP KDQGPPPYKK  240
PHDLKKAWKV GVLTAVIKHM SPDIAKIRKL VRQSKCLQDK MTAKESSTWL AIINQEECLA  300
RELYPNSCPP LSSAGASGSL VVNDCSEYDV EGAEDEPNFD VQECKPDNLH SLNFGMETMR  360
ERLQVHQPTS FPVKGDAITN LEFMRKRKPS SDLNMVVDQK IYTCEFVQCP YSEFCHGFHD  420
RTSRDNHQLS CPFSNRSSEF GAPNLLVNEI KPIIFPHSFV QNKAATSSTK PVPPSFDLSG  480
GVPDDGQKMI SDLMSFYDSN VQGDNNANPN SLATNVKNFS QPNVAHQQDE YFRGQGVRLD  540
GNFFEESNIS SNHHVFTREE GQFDQFKVTS SPFETNHNSN FPMMFGSSFD LASFDYKEDL  600
QGLALPMEKP VETSIWFQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A3e-851753072134Protein ETHYLENE INSENSITIVE 3
4zds_B3e-851753072134Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00367DAPTransfer from AT3G20770Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004288382.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLM9XFM80.0M9XFM8_R
STRINGGLYMA13G03700.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32234200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein